PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000263G0760
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GATA
Protein Properties Length: 364aa    MW: 37499.7 Da    PI: 7.8883
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000263G0760genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.96e-18258293136
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkglk 36 
                      C++C + kTp+WR gp g+ktLCnaCG+++++ +l+
  PH01000263G0760 258 CTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRLM 293
                      ********************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.3E-16252302IPR000679Zinc finger, GATA-type
SuperFamilySSF577168.08E-14256315No hitNo description
PROSITE profilePS5011411.227256288IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.3E-13256290IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.13E-13257304No hitNo description
PfamPF003201.2E-15258293IPR000679Zinc finger, GATA-type
PROSITE patternPS003440258283IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MASEWEMAMG VELGMGMGTY HNAPGITAAP MGHHGNGGGF STAHHFYGMP PMGDAMRVDE  60
LLDLSNAGAH EFFPASATAA AADNGHHLGA MGEPSANTPS ATSSDHQTSM LSFADEFYIP  120
SEEAAELEWL SKFVDDSYSD IPNYSPAAHA AMAAAAAASA ASNGGVNSAG RDSCITAAPG  180
RGARSKRSRA TAAAAAAWHS LVPRPPSQSS PSSSCSSSDF PSSKPARPNG SNSNRGKKIP  240
GAGGAAGEVG MEGGVRRCTH CASEKTPQWR TGPLGPKTLC NACGVRFKSG RLMPEYRPAA  300
SPTFVLTQHS NSHRKVIELR RQKEIILIRG SHRDAAAAAA ASAAAGSAGA TGRPDLMFRD  360
YGVC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0952150.0FP095215.1 Phyllostachys edulis cDNA clone: bphylf031m10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983678.11e-172PREDICTED: GATA transcription factor 2-like
SwissprotO497413e-60GATA2_ARATH; GATA transcription factor 2
TrEMBLK4ABL61e-172K4ABL6_SETIT; Uncharacterized protein
STRINGSi036273m1e-171(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46212955
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.17e-44GATA transcription factor 2